LL-37 5mg Peptide

LL-37 5mg – High-Purity Research Peptide

LL-37 (also known as CAP-18) is a synthetic peptide belonging to the cathelicidin family. It is commonly utilised in laboratory research involving peptide structure, cathelicidin-related pathways, and cellular signalling systems.

Supplied in lyophilised (freeze-dried) form to support stability and handling, this compound is verified at >99.1% purity (HPLC-tested) and includes a full Certificate of Analysis (COA) for batch-specific verification and traceability.

What is LL-37?

LL-37 is a peptide fragment derived from the human cathelicidin antimicrobial protein (hCAP-18). In controlled research environments, it is used as a model compound in studies involving peptide interactions, receptor-associated pathways, and experimental biological systems.

Scientific Identifiers

• Product Name: LL-37 5mg

• Catalogue Number: BWP-LL37-5

• CAS Number: 154947-66-7

• Molecular Formula: C₂₀₃H₃₄₅N₆₁O₄₉S

• Molecular Weight: 4493.34 g/mol

• Sequence: [LL-37, 37 aa]

• Form: Lyophilised Solid

• Purity: >99.1% (HPLC Verified)

• Storage: Store at −20°C, protected from light

• Unit Size: 5mg

Usage and Reconstitution

LL-37 is supplied as a lyophilised solid for stability during storage and transport. For laboratory use, it may be reconstituted with bacteriostatic water or other appropriate solvents under aseptic conditions. Refer to our peptide reconstitution page for full guidance.

Why Order LL-37 from Bluewell Peptides?

• 99.1% purity, HPLC-verified

• COA provided with every batch

• Secure ordering and fast UK delivery

• Transparent, research-focused supplier

• Excellent customer support and trusted reviews

Legal and Safety Information

Bluewell Peptides products are supplied strictly for laboratory research and educational purposes only. They are not approved for human or veterinary use. These compounds are not intended to diagnose, treat, cure, or prevent any disease. Use must comply with all applicable laws and regulations.